FeelDesign LogoFeelDesign
FeelDesign LogoFeelDesign
FeelDesign LogoFeelDesign
FeelDesign LogoFeelDesign

Simple White Room with Yellow Chair

460㎡, Korea Gungoo Bon9 Cafe

460㎡, Korea Gungoo Bon9 Cafe

A calm and inviting white room with a yellow chair and wooden floor, minimalist design
A calm and inviting white room with a yellow chair and wooden floor, minimalist design

Simple White Room with Yellow Chair

interior design · wood

Tags

minimalistwhitecalminvitingsimpleempty

Simple White Room with Yellow Chair

interior design · wood

Tags

minimalistwhitecalminvitingsimpleempty

About this design

A calm and inviting white room with a yellow chair and wooden floor, minimalist design

Style
interior design
Materials
wood

Related interior design designs

  • A modern dining room featuring metal furniture and intricate artwork with a flower and dragon motif.Modern Interior Metal Dining Room
  • A modern industrial lobby featuring stone walls and a large vase with green plants.Modern Industrial Lobby with Stone Walls
  • Luxe living room featuring elegant wooden furniture.Luxury Interior Design with Wood Furniture
  • A minimalist room featuring white windows, wooden flooring, and simple furniture.Minimalist Room with White Windows
  • Industrial-style concrete stairs with metallic handrails and light filtering through a window.Concrete Stairs with Industrial Lighting
  • Decorative paper scroll hanging on a dark wall with a plant, vase, and candle holder.Decorative Paper Scroll
  • A serene bamboo-blinds-living-room with natural lighting and minimalist interior design.Bamboo Blinds Living Room
  • Industrial-style bar stool with metal joints and seating areaIndustrial Bar Stool Metal Joint

Simple White Room with Yellow Chair

460㎡, Korea Gungoo Bon9 Cafe

460㎡, Korea Gungoo Bon9 Cafe

A calm and inviting white room with a yellow chair and wooden floor, minimalist design
A calm and inviting white room with a yellow chair and wooden floor, minimalist design

Simple White Room with Yellow Chair

interior design · wood

Tags

minimalistwhitecalminvitingsimpleempty

Simple White Room with Yellow Chair

interior design · wood

Tags

minimalistwhitecalminvitingsimpleempty

About this design

A calm and inviting white room with a yellow chair and wooden floor, minimalist design

Style
interior design
Materials
wood

Related interior design designs

  • A modern dining room featuring metal furniture and intricate artwork with a flower and dragon motif.Modern Interior Metal Dining Room
  • A modern industrial lobby featuring stone walls and a large vase with green plants.Modern Industrial Lobby with Stone Walls
  • Luxe living room featuring elegant wooden furniture.Luxury Interior Design with Wood Furniture
  • A minimalist room featuring white windows, wooden flooring, and simple furniture.Minimalist Room with White Windows
  • Industrial-style concrete stairs with metallic handrails and light filtering through a window.Concrete Stairs with Industrial Lighting
  • Decorative paper scroll hanging on a dark wall with a plant, vase, and candle holder.Decorative Paper Scroll
  • A serene bamboo-blinds-living-room with natural lighting and minimalist interior design.Bamboo Blinds Living Room
  • Industrial-style bar stool with metal joints and seating areaIndustrial Bar Stool Metal Joint